BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0584 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 1.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 5.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 616 WSRVTVRDLFAVFIIVNIILKC*TSTSRFRLGPDHRVHV 500 W+ V + F++ NII K + S F + P H+ H+ Sbjct: 587 WANVFAKGDMEAFLVKNIIPKLQIALSEFVINP-HQQHL 624 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +1 Query: 397 FIAPLLDYLSIYIFFV 444 ++A ++D L +YIFF+ Sbjct: 473 YVAMVIDRLQLYIFFL 488 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,471 Number of Sequences: 438 Number of extensions: 5062 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -