BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0582 (331 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 33 0.92 UniRef50_A6PLE7 Cluster: Putative uncharacterized protein; n=1; ... 30 8.5 UniRef50_Q54LC7 Cluster: Putative uncharacterized protein; n=1; ... 30 8.5 UniRef50_A1S1F3 Cluster: Putative uncharacterized protein; n=1; ... 30 8.5 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 33.5 bits (73), Expect = 0.92 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 290 RGGARYPIRPIVSR 331 RGGARYPIRPIVSR Sbjct: 260 RGGARYPIRPIVSR 273 >UniRef50_A6PLE7 Cluster: Putative uncharacterized protein; n=1; Victivallis vadensis ATCC BAA-548|Rep: Putative uncharacterized protein - Victivallis vadensis ATCC BAA-548 Length = 838 Score = 30.3 bits (65), Expect = 8.5 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +2 Query: 2 INQLNDHFA-WITPMPVIMLPKDQR 73 + LNDHF W P+P I +PKDQ+ Sbjct: 116 LKALNDHFERWEIPIPRIPVPKDQQ 140 >UniRef50_Q54LC7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 978 Score = 30.3 bits (65), Expect = 8.5 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 190 YVFNRFEWLHLTTVTRIIN*LNFNHNQNKIKKNSRGGPVPNSPYSES 330 Y+ N H TT T IIN +N N+N N +S N+ S S Sbjct: 299 YLMNNATKTHSTTSTPIINSINNNNNNNNNPSSSSSPSSSNNSQSSS 345 >UniRef50_A1S1F3 Cluster: Putative uncharacterized protein; n=1; Thermofilum pendens Hrk 5|Rep: Putative uncharacterized protein - Thermofilum pendens (strain Hrk 5) Length = 240 Score = 30.3 bits (65), Expect = 8.5 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = +2 Query: 17 DHFAWITPMPVIMLPKDQRIDVIHDLSD*KRLSISEN*LKYKKQKTCCLIKYPCFIPPTF 196 D AW+ + +LP + + +IHD+SD L+I L ++ ++++P + P F Sbjct: 24 DVVAWLNDLSPKVLPMGEYVVLIHDVSDLHSLAI----LSRLNRRCTFILEFPVDVDPAF 79 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 317,339,801 Number of Sequences: 1657284 Number of extensions: 5003723 Number of successful extensions: 8047 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8044 length of database: 575,637,011 effective HSP length: 86 effective length of database: 433,110,587 effective search space used: 9961543501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -