BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0579 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 26 5.9 SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc2... 25 7.8 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = -3 Query: 167 DIPYKDGRSL*IQNIFSICLITCLRAWLVNPANEA 63 ++P ++L +++ S+ + CL W+V N+A Sbjct: 364 EVPLNPTQALAVRDALSMAIYNCLFDWIVERVNKA 398 >SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc22 |Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 25 FAKITNTVNQIENASLAGLTNHALKQV 105 + +TN + +EN SLAG TN K+V Sbjct: 337 YYNVTNPFDFMENISLAGKTNFFEKKV 363 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,822,168 Number of Sequences: 5004 Number of extensions: 57320 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -