BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0579 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54040.1 68418.m06721 DC1 domain-containing protein contains ... 28 5.0 At1g02150.1 68414.m00141 pentatricopeptide (PPR) repeat-containi... 28 5.0 >At5g54040.1 68418.m06721 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 596 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -2 Query: 417 CPYFKQNDSGSNYFYESVISFL*NVGYFVSVFHWLFINAFAWPSSWLKNSVQCHY 253 C ++ D G E V N + + ++ N FAWP K+ + CH+ Sbjct: 52 CISYECTDCGLTLHKECVDHLFLNRPFLCNHVLKIYRNTFAWPDPDRKDDLSCHF 106 >At1g02150.1 68414.m00141 pentatricopeptide (PPR) repeat-containing protein low similiarity to DNA-binding protein [Triticum aestivum] GI:6958202; contains Pfam profile: PF01535 PPR repeat Length = 524 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = -3 Query: 458 MLTEDVNLAMPNYNVRTLSRMILGVIIFTSL*LASCKMSVILYPYFTGFSSM 303 M +D+ L + +YN+ S LG + L K V +YP +T FS+M Sbjct: 230 MKQKDIRLDIYSYNIWLSSCGSLGSVEKMELVYQQMKSDVSIYPNWTTFSTM 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,095,301 Number of Sequences: 28952 Number of extensions: 274941 Number of successful extensions: 484 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -