BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0573 (810 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC126368-1|AAI26369.1| 802|Homo sapiens fer-1-like 5 (C. elegan... 31 4.9 BC117324-1|AAI17325.1| 801|Homo sapiens fer-1-like 5 (C. elegan... 31 4.9 >BC126368-1|AAI26369.1| 802|Homo sapiens fer-1-like 5 (C. elegans) protein. Length = 802 Score = 31.1 bits (67), Expect = 4.9 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 197 SFLYLFYCRYRLN*ILFNCLNTISIMLLIMLVTAHHII 310 +F Y+F+ RYR I F ++ I++ML + +A H + Sbjct: 694 NFCYIFWKRYRFKLIAFMVISIIALMLFNFIYSAPHYL 731 >BC117324-1|AAI17325.1| 801|Homo sapiens fer-1-like 5 (C. elegans) protein. Length = 801 Score = 31.1 bits (67), Expect = 4.9 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 197 SFLYLFYCRYRLN*ILFNCLNTISIMLLIMLVTAHHII 310 +F Y+F+ RYR I F ++ I++ML + +A H + Sbjct: 693 NFCYIFWKRYRFKLIAFMVISIIALMLFNFIYSAPHYL 730 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,979,114 Number of Sequences: 237096 Number of extensions: 1862183 Number of successful extensions: 2402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2402 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10036353240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -