BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0572 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0052 + 7827973-7828031,7829012-7829139,7829243-7829305,783... 31 0.73 07_03_1245 + 25154586-25155040,25155519-25155604,25155690-25155733 27 8.9 >05_03_0052 + 7827973-7828031,7829012-7829139,7829243-7829305, 7830323-7830444,7830557-7830672,7830760-7831567, 7831800-7832528,7832638-7832859,7833089-7833184, 7833273-7833467,7834303-7834416,7835368-7835651, 7836216-7836293,7836326-7836449,7836739-7836786 Length = 1061 Score = 30.7 bits (66), Expect = 0.73 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 423 QNRVTELNELTGDSVWLHVNSKNNPADLLS 512 +N + L+ +GD W HV KN+P D LS Sbjct: 49 ENVIASLDLRSGDIFWRHVIEKNDPVDELS 78 >07_03_1245 + 25154586-25155040,25155519-25155604,25155690-25155733 Length = 194 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 21 QEIAMTWSNFIKTLTHLNELRIPRQIRGSNTQFIELHIFTDASQNAYG 164 +E A + NF K + +NEL I R +R EL +TD G Sbjct: 83 KEKAHRYENFKKAMKGINELNIKRGMRSPLAAPTELADYTDEEVERLG 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,502,600 Number of Sequences: 37544 Number of extensions: 227047 Number of successful extensions: 354 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -