BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0566 (590 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 44 0.003 UniRef50_UPI0000E7FE45 Cluster: PREDICTED: hypothetical protein;... 32 8.7 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 44.0 bits (99), Expect = 0.003 Identities = 20/35 (57%), Positives = 24/35 (68%) Frame = -1 Query: 578 FLLLRWVHELTTNLVANWLLKPIDIYKLNAPPTLR 474 FLLLRWV ELT +LV + P +Y +NAPPT R Sbjct: 154 FLLLRWVDELTAHLVLSGYWSPRHLYDVNAPPTSR 188 >UniRef50_UPI0000E7FE45 Cluster: PREDICTED: hypothetical protein; n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 73 Score = 32.3 bits (70), Expect = 8.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 219 IFALLKCTGFGDHDSSGKQSCVTVCFG*RIFYW 317 +F L CTG G G + C +C +F+W Sbjct: 4 VFCLFSCTGSGSCCDPGARPCTWICLNLMMFFW 36 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,228,287 Number of Sequences: 1657284 Number of extensions: 13114969 Number of successful extensions: 28545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28537 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41073165837 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -