BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0565 (624 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26730.1 68416.m03342 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At1g70350.1 68414.m08093 expressed protein 28 4.4 >At3g26730.1 68416.m03342 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 772 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 118 VCIILSPPSPIKTP-ATPYTLLLRFSACGSHTLTVAAMLNFRLWSVXXXXXXC 273 +C+ S PSP++ P Y L + ++CG H +L + L V C Sbjct: 233 ICVRYSTPSPVQCPICLEYPLCPQITSCG-HIFCFPCILQYLLTGVDNHKVDC 284 >At1g70350.1 68414.m08093 expressed protein Length = 105 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 390 RVPVHYEAGINSDPLVSTTATRLIFPTLLLRSKS 289 RVPV AGI+ PL S TA+ L+ L L +++ Sbjct: 60 RVPVELSAGISLIPLHSVTASALLTSLLSLSNQN 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,458,329 Number of Sequences: 28952 Number of extensions: 271916 Number of successful extensions: 712 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -