BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0564 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g47800.1 68414.m05318 F-box family protein contains F-box dom... 29 2.7 At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 28 8.2 >At1g47800.1 68414.m05318 F-box family protein contains F-box domain Pfam:PF00646 Length = 387 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -1 Query: 373 MVSGYRRPWTSAM-PGAEPSRLPTKLSKHCLRYLP-NYRSIM*SS*PK 236 +VS PW A P +P R CLRYLP +Y+S+M PK Sbjct: 89 LVSTPLLPWDPAPGPPVKPHRFGLFWRARCLRYLPKHYKSLMEELKPK 136 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 410 IALLGRRAYGPADGEWLP-SPMDFSNARGRA 321 + + G + Y P GEW+ SP+D GRA Sbjct: 851 VIIKGTQVYNPERGEWMELSPLDVMQMIGRA 881 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,246,875 Number of Sequences: 28952 Number of extensions: 369884 Number of successful extensions: 662 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -