BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0561 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.1 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 4.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = +1 Query: 244 YLKNAGVKDAEAQVAQGSFTYTSPEGIPISVSYVADENGFRPEGAHLPTPPPI 402 ++K+ + D A + + +S EG+P+ + V +G G+ PP+ Sbjct: 1078 FVKDGVIPDPVALKSAQQGSSSSSEGVPLKGTAVPPPSGSSGPGSTGSKSPPV 1130 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 291 LCNLGFGILNSSVLEVTLFLSCDAI 217 + N+G + +V VTL LSCDA+ Sbjct: 251 VANVGVAFM-INVGTVTLILSCDAV 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,163 Number of Sequences: 336 Number of extensions: 2280 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -