BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0560 (854 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharo... 27 3.4 SPAC4A8.07c |||sphingoid long chain base |Schizosaccharomyces po... 27 3.4 SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosacchar... 26 5.9 SPAC1399.05c |||transcription factor, zf-fungal binuclear cluste... 26 7.8 >SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 237 IWPLHSFLIHFHAGVRQIAPE*LVY 163 +W +H FL HFH V +A LVY Sbjct: 590 LWEIHPFLNHFHPTVSLLAKS-LVY 613 >SPAC4A8.07c |||sphingoid long chain base |Schizosaccharomyces pombe|chr 1|||Manual Length = 458 Score = 27.1 bits (57), Expect = 3.4 Identities = 26/102 (25%), Positives = 39/102 (38%), Gaps = 3/102 (2%) Frame = -2 Query: 508 ISPDMKLGRAEVITRSGSVALATVYDKLGRLTFGYCYL---HGLFYLVFHYNYIKHNLFR 338 I+PD K+ A G + + VY K R + + +G FY H NY K FR Sbjct: 353 IAPDAKMFPA-ASNDDGLIDVVIVYSKQFRKSLLSMFTQLDNGGFYYSKHLNYYKVRSFR 411 Query: 337 CEDSKIGMLNTLLLTGVIVILWPRLLVINPERSNMATPLLSY 212 G + L G L P + P+ +P+ + Sbjct: 412 FTPVNTGKRHYFALDGESYPLEPFECRVAPKLGTTLSPVAGF 453 >SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 26.2 bits (55), Expect = 5.9 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -2 Query: 397 LHGLFYLVFH--YNYIKHNLFRCEDSKI 320 LH FYL+FH +N +K + R S+I Sbjct: 118 LHSSFYLLFHEPFNILKGSTLRFSQSRI 145 >SPAC1399.05c |||transcription factor, zf-fungal binuclear cluster type|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.8 bits (54), Expect = 7.8 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = -2 Query: 457 SVALATV--YDKLGRLTFGYCYLHGLFYLVFHYNYIKHNLFRCEDSKI--GMLNTLLLTG 290 S AL T+ +L C H LF+ F + ++ + ++ ++ +L Sbjct: 398 SYALKTIDAIFELSAYDMSRCSDHVLFHAGFASASLLRLIYAAKTKEVDTSIVQPKVLND 457 Query: 289 VIVILWPRLLVINPERSNMATPLLSY 212 ++ +W LLVI+ ++ ++AT +Y Sbjct: 458 LVTKIWKWLLVISVDQYHLATKFANY 483 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,571,064 Number of Sequences: 5004 Number of extensions: 75217 Number of successful extensions: 190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 424464280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -