BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0560 (854 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 3.9 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.1 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 24.6 bits (51), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 811 VVFTFTLIAIVYALMDMDPGR 749 + FT L+ +VYAL ++ P R Sbjct: 507 ISFTLALVPVVYALAEIVPSR 527 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 5.1 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 578 CFSFYNKLAFPRSGPTKKYYRFHDIARHEAWPR*SDYEERKRCT 447 CFS + A + KKY D ARH + + E+R CT Sbjct: 463 CFSLFRGRALMENSVMKKYTTKSDQARH--YVQYDQGEDRWLCT 504 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 903,311 Number of Sequences: 2352 Number of extensions: 18244 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -