BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0556 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.7 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 5.0 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 5.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 5.0 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 5.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.7 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -1 Query: 374 QNASAPSIFRAG--CFGR*VVAHSLADSDFHGHRPAVMSDQRLS 249 + A AP++ AG R A H HRPA+ +R++ Sbjct: 274 ERAPAPAVRAAGDAAAARGAARADGAGGPLHDHRPALAQQRRVA 317 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 519 PRSAPTEAPSGLTPR 475 PRS+P E S L+P+ Sbjct: 154 PRSSPAETASSLSPQ 168 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 277 GRWPWKSESAKECATTHLPKQPAL 348 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 277 GRWPWKSESAKECATTHLPKQPAL 348 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 519 PRSAPTEAPSGLTPR 475 PRS+P E S L+P+ Sbjct: 145 PRSSPAETASSLSPQ 159 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = +3 Query: 603 VDPKLKERSYVDVACFFIIFKNNEK*RPLSERESGSYSGTRQRNRFNNRSLVFKNECST 779 V+PKL + + + KNN++ LS+ + + + + R + KNE T Sbjct: 284 VEPKLNKHEDLPQDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLCKNEDET 342 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/59 (23%), Positives = 26/59 (44%) Frame = +3 Query: 603 VDPKLKERSYVDVACFFIIFKNNEK*RPLSERESGSYSGTRQRNRFNNRSLVFKNECST 779 V+PKL + + + KNN++ LS+ + + + + R + KNE T Sbjct: 176 VEPKLNKHEDLPQDLSMKLSKNNDQCLDLSKTKETNLEKSNLNHNEQLRKYLCKNEDET 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,036 Number of Sequences: 336 Number of extensions: 4370 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -