BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0556 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p... 33 0.036 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 3.1 SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces... 26 7.2 SPAC328.07c |||heavy metal ion homeostasis protein |Schizosaccha... 25 9.5 >SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 33.5 bits (73), Expect = 0.036 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 579 TRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALR-RARPTRYGLMIPN 418 ++NP R +SR+ PP+SAP++ S + P A + R R R+G+ N Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGVAAKN 245 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 3 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 95 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 25.8 bits (54), Expect = 7.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 609 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRA 451 D L R Q RNP PR+ R S L P S + + + L +P +L +A Sbjct: 118 DLLLRHQQKIHRNPQPRR-RRRSTTALPNPSLSNVSVSTTNLASKPVISLPQA 169 >SPAC328.07c |||heavy metal ion homeostasis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 277 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 773 TLVFKDEGTIIETVPLPGSGIGTGFPFAQRALFFIIF 663 T+V D G+ + + G +GTGF F A I+F Sbjct: 139 TMVIPDYGS--NEIYIDGMSVGTGFSFVWSACVAILF 173 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,414,748 Number of Sequences: 5004 Number of extensions: 72239 Number of successful extensions: 191 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -