BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0556 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.6 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 4.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 8.3 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 2.7 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -1 Query: 524 YHQDLHRRRLQAGSRPDPSALSVAH-VLLVTA**YQIKNLASHVPVTVVYRQNASAPSI 351 YH D H A RP+PSA+ +A V V A + + A H PV Q+ A I Sbjct: 128 YHAD-HHTGFNAVVRPEPSAVKIAQPVHKVIAQPVHVSSYA-HAPVAHATVQHHHAAPI 184 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 654 IIFKNNEK*RPLSERESGSYSGTRQRNRF 740 IIF N + + ER GS+S +RN F Sbjct: 37 IIFVRNNRALLIYERMGGSWSEVHKRNNF 65 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 575 ETLLHVSPPGPRWSICYYHQDLHRRRLQAGSRPDPSALSVAHVLLVTA 432 +++ ++S P WSI Y+ +D+ +QA + + +LVTA Sbjct: 210 QSVRNLSRPITGWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTA 257 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 576 RNPSPRQSSRASLEYLLLPPRSAPTEAPSG 487 RN ++ RAS ++PPRS A G Sbjct: 225 RNQHEQEQPRASTSRAVMPPRSEALTAVRG 254 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 870,889 Number of Sequences: 2352 Number of extensions: 18180 Number of successful extensions: 306 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -