BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0554 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0190 + 12448027-12450825 29 3.5 10_07_0098 - 12844631-12845074,12845329-12846570 28 8.1 >04_03_0190 + 12448027-12450825 Length = 932 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 533 LKINDAHKKNHCRLHCRISNVLY*ICQS 450 +K N+ + HCR+HC + V +C+S Sbjct: 493 MKRNENGRVKHCRMHCIVREVTISLCKS 520 >10_07_0098 - 12844631-12845074,12845329-12846570 Length = 561 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -3 Query: 511 KKTIVDYIVEFQMYFIRFVNQKETLLSKTALVHFN 407 KK +VDY+V+F+ + FV +L +AL++FN Sbjct: 14 KKVLVDYLVKFRWILVIFV-----VLPISALIYFN 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,454,750 Number of Sequences: 37544 Number of extensions: 187580 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -