BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0551 (727 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.4 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 4.4 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 7.7 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -1 Query: 139 YNLRSVSQLPEGMSTHEYVEKKAGIDPGGVTTDPPPVRPSSN 14 +NL SV Q + T+++++ K + V PP P+++ Sbjct: 182 HNLSSVPQPQPVLPTYKWMQVKRNVPKPTVPKIPPAEFPTTS 223 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -1 Query: 139 YNLRSVSQLPEGMSTHEYVEKKAGIDPGGVTTDPPPVRPSSN 14 +NL SV Q + T+++++ K + V PP P+++ Sbjct: 182 HNLSSVPQPQPVLPTYKWMQVKRNVPKPTVPKIPPAEFPTTS 223 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.4 bits (43), Expect = 7.7 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -2 Query: 291 RQLEKTSISLKISSAQ--SDNSEGTLTETALP 202 R LEKTS LKI A+ + ++ L +LP Sbjct: 169 RALEKTSEELKIPKAKINTGKTQYNLNSKSLP 200 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,122 Number of Sequences: 336 Number of extensions: 3616 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -