BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0551 (727 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U54982-1|AAC16665.1| 850|Drosophila melanogaster stn-A protein. 29 8.5 AE014298-3233|ABI31011.1| 850|Drosophila melanogaster CG12500-P... 29 8.5 AE014298-3232|EAA46058.2| 850|Drosophila melanogaster CG12500-P... 29 8.5 >U54982-1|AAC16665.1| 850|Drosophila melanogaster stn-A protein. Length = 850 Score = 28.7 bits (61), Expect = 8.5 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -1 Query: 124 VSQLP----EGMSTHEYVEKKAGIDPGGVTTDPPPVRPSSNMRI 5 V+QLP E S E+ E+++G +PG PPPVRP + I Sbjct: 401 VAQLPTEAFEAGSWAEF-EEQSGQEPGKPKRPPPPVRPPTGPHI 443 >AE014298-3233|ABI31011.1| 850|Drosophila melanogaster CG12500-PB, isoform B protein. Length = 850 Score = 28.7 bits (61), Expect = 8.5 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -1 Query: 124 VSQLP----EGMSTHEYVEKKAGIDPGGVTTDPPPVRPSSNMRI 5 V+QLP E S E+ E+++G +PG PPPVRP + I Sbjct: 401 VAQLPTEAFEAGSWAEF-EEQSGQEPGKPKRPPPPVRPPTGPHI 443 >AE014298-3232|EAA46058.2| 850|Drosophila melanogaster CG12500-PA, isoform A protein. Length = 850 Score = 28.7 bits (61), Expect = 8.5 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -1 Query: 124 VSQLP----EGMSTHEYVEKKAGIDPGGVTTDPPPVRPSSNMRI 5 V+QLP E S E+ E+++G +PG PPPVRP + I Sbjct: 401 VAQLPTEAFEAGSWAEF-EEQSGQEPGKPKRPPPPVRPPTGPHI 443 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,215,212 Number of Sequences: 53049 Number of extensions: 656025 Number of successful extensions: 1248 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3252477558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -