BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0550 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 24 4.6 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 6.1 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 24.2 bits (50), Expect = 4.6 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 260 RPEQLRMMNLPTLDWP--RIRPTKCSTKWTSFSKVILLG*KFQRR 388 RPE+ +++ + P R+R + WTSF++ LL F++R Sbjct: 80 RPEEDELIDQKAIRAPQLRLRFGRNDPLWTSFNENALLEENFEKR 124 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 507 LLPALNDFSLIFSI*GHVQFRRQVSQER 424 L P++ND + F + G+ F ++SQ+R Sbjct: 531 LTPSVNDLNHPFHLHGYQMFVMEMSQDR 558 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,042 Number of Sequences: 2352 Number of extensions: 14713 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -