BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0549 (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5B9S9 Cluster: Putative uncharacterized protein; n=2; ... 34 2.9 UniRef50_Q8I3N2 Cluster: Putative uncharacterized protein PFE116... 33 8.8 UniRef50_Q33565 Cluster: CR3 protein; n=2; Trypanosoma brucei|Re... 33 8.8 >UniRef50_Q5B9S9 Cluster: Putative uncharacterized protein; n=2; Trichocomaceae|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 1570 Score = 34.3 bits (75), Expect = 2.9 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 454 WEISKPPKSNITYVVKILNVSDTGVPSFEKISASETHG 567 W I+KPP ++ V+++L SDT PS K A +G Sbjct: 236 WSIAKPPGKDVPRVIRVLKRSDTSSPSEPKWMAWSKNG 273 >UniRef50_Q8I3N2 Cluster: Putative uncharacterized protein PFE1160w; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFE1160w - Plasmodium falciparum (isolate 3D7) Length = 1101 Score = 32.7 bits (71), Expect = 8.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 154 LNHTFIYKAFLCKSRFYFHIKHV**FCFD*NVLLSWFFSITLLYYHN 294 L+H FI+ LC + ++ F ++ N+LL W + + Y N Sbjct: 782 LSHNFIHTLNLCNENMFLKRNNISNFLYNKNILLKWLNNFMIYYLEN 828 >UniRef50_Q33565 Cluster: CR3 protein; n=2; Trypanosoma brucei|Rep: CR3 protein - Trypanosoma brucei Length = 70 Score = 32.7 bits (71), Expect = 8.8 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 79 LWIFYLCNAD*VLLLLCKIFNYCFFLNHTFIYKAFLCKSRFYFHI 213 L++ + C L LC +F++CF L+ F++ L F+F I Sbjct: 13 LFVHFFCFLFVCDLFLCLLFSFCFLLDFCFLFNMGLLLCLFFFFI 57 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,606,382 Number of Sequences: 1657284 Number of extensions: 12826013 Number of successful extensions: 24582 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24566 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -