BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0548 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.4 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 4.3 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 7.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.4 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +3 Query: 36 VHLSKQKQTQDKMC-DRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFD 212 +H ++ K+T DK+C + V+ A ++ + +EK + A +KK + Sbjct: 1689 IHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEK----NEAAMKLKKRIE 1744 Query: 213 KKYNP 227 K NP Sbjct: 1745 KGANP 1749 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 534 TVFTYTVYLIRNSQCWTLTASYLF 605 T F VY RNS+ W +T + + Sbjct: 204 TGFALLVYDFRNSRSWRITNNLFY 227 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 7.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -3 Query: 158 ERLSCTVNSILLHLFAH 108 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,155 Number of Sequences: 438 Number of extensions: 4035 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -