BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0546 (417 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103,250... 29 1.5 06_03_0913 + 25913231-25913609,25913702-25913775,25914400-259145... 29 1.5 02_01_0624 - 4681834-4682298,4684250-4684398,4684479-4684557,468... 27 4.6 11_06_0468 - 23953075-23953093,23954046-23955106 27 6.0 03_05_0530 - 25306788-25306919,25307446-25308037,25308152-253089... 27 6.0 01_06_1749 - 39636951-39638102 27 8.0 >08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103, 2503200-2503289,2503400-2503517,2505548-2505678, 2505756-2506025,2507175-2507308,2507635-2508088 Length = 452 Score = 29.1 bits (62), Expect = 1.5 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 17 RCTGVRIPQAGTNFSNEIRTQQMFPIDFHGE 109 RCTGV I G N +I T DFHGE Sbjct: 159 RCTGVVIGWDGANKRAKILTAASVVCDFHGE 189 >06_03_0913 + 25913231-25913609,25913702-25913775,25914400-25914540, 25914834-25914946,25915359-25915491,25916213-25916351, 25916428-25916527,25916906-25916963,25917122-25917199, 25917278-25917376,25917657-25917735,25917826-25917974, 25918529-25918834,25918994-25919032 Length = 628 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +1 Query: 262 WSSRCNYTEILELISRGGWRIYVVDVYGFQ*T 357 WS+ + ++ EL+ + G ++ V D+YG+Q T Sbjct: 169 WSAVRGHIQVAELLLKEGAKVDVADLYGYQAT 200 >02_01_0624 - 4681834-4682298,4684250-4684398,4684479-4684557, 4684827-4684925,4685004-4685081,4685231-4685288, 4685814-4685913,4686000-4686008,4686105-4686138, 4686729-4686911,4687099-4687126,4687268-4687380, 4688253-4688459,4689212-4689511 Length = 633 Score = 27.5 bits (58), Expect = 4.6 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 262 WSSRCNYTEILELISRGGWRIYVVDVYGFQ*T 357 WS+ + ++ EL+ + G ++ D+YG+Q T Sbjct: 140 WSAVRGHIQVAELLLKEGAKVDAADLYGYQTT 171 >11_06_0468 - 23953075-23953093,23954046-23955106 Length = 359 Score = 27.1 bits (57), Expect = 6.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 Query: 292 RSQYSYNGYSTLRTETHYCFTAEIGGVVVPTHADSQ 185 R +Y NGYS F +GGV V HAD Q Sbjct: 78 RIRYYPNGYSQSTAGHVSVFVYRVGGVDVGLHADVQ 113 >03_05_0530 - 25306788-25306919,25307446-25308037,25308152-25308975, 25309533-25309592,25310115-25310180,25310318-25310461, 25310616-25310756,25310898-25311056,25311818-25311884, 25311986-25312158,25312237-25312333,25312410-25312528, 25312867-25312951,25313120-25313321,25314456-25314633 Length = 1012 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 235 FTAEIGGVVVPTHADSQEVLPPVINYANYNFAGLIFITRCYSFTVEVN 92 FT E G THAD+Q P I + + + G++++ C+ + ++ Sbjct: 731 FTRE--GDATGTHADAQRQPWPWIQHGHAYWRGVLYVNTCHVMRISLS 776 >01_06_1749 - 39636951-39638102 Length = 383 Score = 26.6 bits (56), Expect = 8.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 285 SIVTTATPPFEPKRITA 235 S+ + A PPF+P RIT+ Sbjct: 165 SVASAAAPPFDPSRITS 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,715,967 Number of Sequences: 37544 Number of extensions: 253682 Number of successful extensions: 548 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 754585524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -