BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0545 (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 3.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.6 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 290 HVKHKHKLYINNCYRLNSTI 231 H + +HKL + CY +S + Sbjct: 233 HQQKRHKLRVTRCYSSDSAV 252 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 9.6 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +1 Query: 511 LKKQYKIKTSKFTPVQQALIASLNSTITELENIWNTVDNWVDNESLFPDKN 663 + +Y +K S TP N+T E W+++DN N+ + +N Sbjct: 330 VNSKYILK-STLTPKLARKQFQKNTTGLERSRSWSSLDNTNTNDQDYSSQN 379 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,609 Number of Sequences: 438 Number of extensions: 3814 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -