BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0544 (559 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 6.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 6.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.4 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +2 Query: 182 SNNRFVSTSYINRITRNNDIPNIRNVFQGIS 274 +NN + + +Y N NN+ N + ++ I+ Sbjct: 92 NNNNYNNNNYNNYNYNNNNYNNYKKLYYNIN 122 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 6.4 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = +2 Query: 143 NLGNNRYQPGYQLSNNRFVSTSYINRITRNNDIPNIRNVFQGISDPQINSLRQLRRMDNV 322 N NN Y+ Y N + +YI I IP V+ G P+ + + + Sbjct: 323 NYNNNNYKYNYNNYNKKLYYKNYIINI---EQIPVPVPVYYGNFPPRPMG-PWISMQEQI 378 Query: 323 PDFHY 337 P F Y Sbjct: 379 PRFRY 383 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 492 AKSMPTHATFKVLM*LC 442 A ++P HAT + M LC Sbjct: 439 ASNIPVHATLEKFMILC 455 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 52 RIQFIDYAXICKKTGTR 2 R QFID C K G R Sbjct: 94 REQFIDMVARCNKAGVR 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,916 Number of Sequences: 438 Number of extensions: 3304 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -