BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0544 (559 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15620.1 68418.m01828 F-box family protein contains F-box dom... 34 0.074 At1g32190.1 68414.m03959 expressed protein 33 0.13 At5g15260.1 68418.m01787 expressed protein predicted proteins, A... 28 4.9 At4g39770.1 68417.m05632 trehalose-6-phosphate phosphatase, puta... 28 4.9 At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 28 4.9 At3g01810.1 68416.m00123 expressed protein 27 8.5 >At5g15620.1 68418.m01828 F-box family protein contains F-box domain Pfam:PF00646 Length = 440 Score = 33.9 bits (74), Expect = 0.074 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 11 GFFTNXRIVNKLYPNQASFVADNTRLLTSTPCGFTNVLSA-PSVRNLGNNRYQPGYQLSN 187 GF + N L P + + D+ R S C FT +LSA P + L +R Sbjct: 131 GFVIDILPKNALLPALKTLILDSVRFYASDGCAFTRLLSASPVLEELVIDRLN-WEHWKG 189 Query: 188 NRFVSTSYINRIT 226 +RFVS+ + R+T Sbjct: 190 SRFVSSPTLKRLT 202 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/65 (30%), Positives = 24/65 (36%) Frame = -3 Query: 326 LARCPCAAIGAMSLFEGLKCPEIHCVCWGYRCYE*FCLCMKCSQTGC*IIDSPADICCFQ 147 ++ C C S F KCP+ C CW C+KC T C CC Sbjct: 349 VSSCCCPTFKCSSCFGKPKCPK--CSCW---------KCLKCPDTEC-----CRSSCCCS 392 Query: 146 GCVHW 132 GC W Sbjct: 393 GCFSW 397 >At5g15260.1 68418.m01787 expressed protein predicted proteins, Arabidopsis thaliana Length = 234 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 311 MDNVPDFHYHTKQTRSNA 364 M + PDFH+H+KQ+R+++ Sbjct: 17 MAHSPDFHHHSKQSRTSS 34 >At4g39770.1 68417.m05632 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis thaliana] GI:2944180; contains Pfam profile PF02358: Trehalose-phosphatase Length = 349 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 74 DNTRLLTSTPCGFTNVLSAPSVRNLGNNRYQPGYQLSNNRFVSTSYINRITRNN--DIPN 247 D+ LL F ++ + + + PG Q+ NN+F + + R+ NN D+ N Sbjct: 175 DSKSLLCQPATEFLPMIDEVYHKLVEKTKSTPGAQVENNKFCVSVHFRRVDENNWSDLAN 234 Query: 248 -IRNVFQ 265 +R+V + Sbjct: 235 QVRSVMK 241 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +2 Query: 29 RIVNKLYPNQASFVADNTRLLTSTPCGFTNVLSAPSVRNLGNNRYQPGYQLSNNRF 196 R+ +K+Y A F ADN L T G TNV + LG N PG ++ + Sbjct: 508 RVQSKVY-GTALFKADNILLCAPTGAGKTNVAVLTILHQLGLN-MNPGGTFNHGNY 561 >At3g01810.1 68416.m00123 expressed protein Length = 921 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +2 Query: 326 DFHYHTKQTRSNAVRQNFPETNVRTPEGVQNALQQNPRLHNHMRTLKVA 472 D H+ T S++ ++ +VRT E + +NPR + H R+ V+ Sbjct: 207 DISSHSSLTVSSSTLESNGGFSVRTEEEEHERINKNPRGNGHERSKSVS 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,376,732 Number of Sequences: 28952 Number of extensions: 265471 Number of successful extensions: 624 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -