BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0542 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.71 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.8 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 0.71 Identities = 18/65 (27%), Positives = 28/65 (43%) Frame = -3 Query: 258 SHGQLYVACSRVGKPSSLFVLAKDGLTKNIVHAAALKD*YYVMN*LYIGIIITFNKLKQL 79 SHG+L +RV PS F A D L + D + +++ +I L Sbjct: 969 SHGELLHRMNRVPSPSCSFCSAIDTLEHKFAGCRRVADAWQILHQRISVVISGCPSSSTL 1028 Query: 78 MFGVL 64 +FG+L Sbjct: 1029 LFGLL 1033 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 263 VFHTDNYTLHALEWVNH-QVCLY*LKTG*QKILFTLQH*KIN 141 +F T ++ H + WVNH +VC + ++ F H K++ Sbjct: 212 LFVTARHSEHGMLWVNHLKVCFDKITKQRGRLPFKFLHIKLD 253 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,004 Number of Sequences: 2352 Number of extensions: 15463 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -