BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0540 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56160.1 68416.m06242 expressed protein 32 0.49 At2g48050.1 68415.m06014 expressed protein ; expression supporte... 29 4.5 >At3g56160.1 68416.m06242 expressed protein Length = 436 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +2 Query: 611 LNMSCQKVSF*KLVFSGTSGLALPLALLKSMGDGNHSPSVGC 736 ++ S Q++ F K + S S LPLAL+ +G G +P++GC Sbjct: 88 ISASAQRLYFGKELLSFASDNFLPLALVSGVGLGFANPTLGC 129 >At2g48050.1 68415.m06014 expressed protein ; expression supported by MPSS Length = 1500 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -1 Query: 774 FFFFFLPCKQTSAQPTDGEWLPSPMDFS---NARGRAKPLVPLK 652 F + Q+S DG+W+PS DF+ NARG K L ++ Sbjct: 1093 FLIYIFTLIQSSITVKDGDWVPS-ADFTSRRNARGSQKDLTRIR 1135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,109,238 Number of Sequences: 28952 Number of extensions: 294321 Number of successful extensions: 605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -