BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0538 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) 29 5.4 SB_43258| Best HMM Match : BacA (HMM E-Value=1.8) 28 9.5 >SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) Length = 497 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 430 ELLFINNASINFKLIYILDRYLKHNTN 510 E L +NN ++ ++ LD Y+KHN N Sbjct: 364 EELHLNNITVGKGVLEFLDEYMKHNPN 390 >SB_43258| Best HMM Match : BacA (HMM E-Value=1.8) Length = 215 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 495 KAQHKRGHILFLLKRKIAFTKVCIFILH-IPMSTRHT 602 KA H GHIL L + FT + I++ + +S RHT Sbjct: 27 KASHGVGHILNDLVSSVWFTYLIIYLTKVVQLSNRHT 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,810,064 Number of Sequences: 59808 Number of extensions: 373531 Number of successful extensions: 997 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -