BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0536 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1035 + 30283456-30283536,30284823-30285359,30285508-302865... 28 6.6 07_03_1216 + 24940426-24940714,24940800-24940877,24941954-249421... 28 8.7 >04_04_1035 + 30283456-30283536,30284823-30285359,30285508-30286512, 30286718-30287042,30287563-30287818,30287901-30288117, 30288743-30289095,30289330-30289833,30291267-30292467, 30292614-30292970,30293258-30293495,30294083-30295125, 30295234-30296649,30296731-30296855,30297036-30297314, 30297352-30297382,30298957-30299022,30299447-30299689, 30299848-30299898,30299980-30300071,30300182-30300249, 30300515-30300600,30300720-30300824,30300994-30301127, 30302403-30302436,30302620-30302892,30303019-30303288, 30303384-30303974,30304065-30304214 Length = 3376 Score = 28.3 bits (60), Expect = 6.6 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%) Frame = -2 Query: 527 EHCCSLCVESLSRL-LRQPWKEMSLSVVLNLYIFY*NIFQFL----NEGHTYTAKTIIWI 363 EHC +LC E L + L Q + SV+ + + N+ + + G T T ++W Sbjct: 208 EHCLALCTEQLLSINLNQSQVDAIESVISAVQCRHLNLMKLIWGPPGTGKTKTVSALLWA 267 Query: 362 VCSLQRR 342 + L+ R Sbjct: 268 LACLKCR 274 >07_03_1216 + 24940426-24940714,24940800-24940877,24941954-24942129, 24942298-24942492 Length = 245 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 460 DISFH-GCRKRRLRDSTHNEQQCSYSIASLL-RLPT 561 D S H GC+ RR +S H E C Y++ +L LPT Sbjct: 176 DASSHKGCQIRR--ESAHGESVCCYNVRALFDELPT 209 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,019,916 Number of Sequences: 37544 Number of extensions: 263983 Number of successful extensions: 455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -