BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0536 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical pr... 28 5.9 >U51994-2|AAA96065.3| 1311|Caenorhabditis elegans Hypothetical protein R03G5.3 protein. Length = 1311 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = -3 Query: 679 FIT*SQFPLYCNWMR*LLSRNKQVKCPRVHTIRFTVSICRLVIAVGWQYCKNTAAHCVLN 500 F+T +F NW R Q+ + +T C+L + + + + K+T ++CV Sbjct: 968 FLTSVEFSKLKNWYH--FGREPQLTNSANYIWNYTPENCKLFLKIPFFFIKDTYSNCVFR 1025 Query: 499 PLVAFY 482 + F+ Sbjct: 1026 ESIFFF 1031 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,381,475 Number of Sequences: 27780 Number of extensions: 278771 Number of successful extensions: 686 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -