BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0535 (354 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC594.02c |||conserved fungal protein|Schizosaccharomyces pomb... 25 4.5 SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 24 6.0 >SPCC594.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 489 Score = 24.6 bits (51), Expect = 4.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 221 IKPVYFVW*QPNFFVR 268 +KP+YF W NF +R Sbjct: 137 VKPIYFGWWPENFLLR 152 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 24.2 bits (50), Expect = 6.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 91 VNLDLLNHSEIQVILIHSYFTEHQRAEPTLSH 186 V + LL +S + + L+HS + RA PTL H Sbjct: 127 VKICLLAYS-VHLFLLHSLRMIYPRARPTLYH 157 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,340,863 Number of Sequences: 5004 Number of extensions: 23579 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 105935336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -