BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0535 (354 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40957| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_6164| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.4 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_34836| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 SB_15922| Best HMM Match : DEAD (HMM E-Value=0.25) 27 5.8 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 27 5.8 SB_27831| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.6e-11) 26 7.7 SB_27542| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_32798| Best HMM Match : PufQ (HMM E-Value=9.4) 26 7.7 >SB_40957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 301 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 63 TISSLTSCNCEFRSLKSLGNSS 128 T +++SCNC R+L S GNSS Sbjct: 263 TWCTVSSCNCSTRTLSSWGNSS 284 >SB_6164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 465 Score = 27.1 bits (57), Expect = 4.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 48 KILNNTISSLTSCNCEFRSLKSLGNSSDPH 137 KI NN+I+S TSC E +SL N H Sbjct: 311 KISNNSINSDTSCVFELQSLNIASNGLKLH 340 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 26.6 bits (56), Expect = 5.8 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 195 VYKL*TINKSSQYILFGNNLISSFDTVKQLSLISPVLI 308 +YK+ I+KSS+ +L + + FD + L+ I V+I Sbjct: 2870 IYKMIYIDKSSKALLAKTHATTGFDYIVMLNTIENVVI 2907 >SB_34836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 26.6 bits (56), Expect = 5.8 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +3 Query: 39 IPMKILNNT-ISSLTSCNCEFRSL---KSLGNSSDPHTQLFYGTSKS*TNIIALICVYKL 206 +P K+L N+ + + TSCNCE L + +S H TS S T + +Y+L Sbjct: 54 LPQKLLENSYMGNTTSCNCEVLVLSYKQRCNRNSSGHISYTLNTSISWT--VGRNILYRL 111 Query: 207 -*TINKSSQYILF 242 ++K Y +F Sbjct: 112 SQALDKQYLYYIF 124 >SB_15922| Best HMM Match : DEAD (HMM E-Value=0.25) Length = 409 Score = 26.6 bits (56), Expect = 5.8 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +3 Query: 39 IPMKILNNT-ISSLTSCNCEFRSL---KSLGNSSDPHTQLFYGTSKS*TNIIALICVYKL 206 +P K+L N+ + + TSCNCE L + +S H TS S T + +Y+L Sbjct: 243 LPQKLLENSYMGNTTSCNCEVLVLSYKQRCNRNSSGHISYTLNTSISWT--VGRNILYRL 300 Query: 207 -*TINKSSQYILF 242 ++K Y +F Sbjct: 301 SQALDKQYLYYIF 313 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 26.6 bits (56), Expect = 5.8 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +1 Query: 112 HSEIQVILIHSYFTEHQRAEPTLSH*FASINYKQSIN 222 HS +Q+I+++S + ++ TLS F NY ++++ Sbjct: 605 HSGVQIIIVNSRSVRTKSSKRTLSDEFKHHNYDETLS 641 >SB_27831| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.6e-11) Length = 350 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 242 W*QPNFFVRHSETIIINIARPNLKLWCN 325 W FFV +T I + PN K+W N Sbjct: 36 WIPDTFFVNSVDTEIHKMISPNKKVWLN 63 >SB_27542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 26.2 bits (55), Expect = 7.7 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +3 Query: 39 IPMKILNNT-ISSLTSCNCE 95 +P K+L N+ + + TSCNCE Sbjct: 102 LPQKLLENSYMGNTTSCNCE 121 >SB_32798| Best HMM Match : PufQ (HMM E-Value=9.4) Length = 140 Score = 26.2 bits (55), Expect = 7.7 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -1 Query: 234 YTGLIY*LFIIYRRKLMR*CWFSSLMF--RKIAVYEDHLNFRVI*EI*IHNYMTSMRKL 64 Y G+I+ + +++ K+ R C FS++ F R +A LN V+ + NY ++++ Sbjct: 33 YNGVIFTIAFVWQNKIPRTCSFSTIWFIARYLAYSTSALNPLVLFAL-NENYRNGLKRV 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,116,014 Number of Sequences: 59808 Number of extensions: 145635 Number of successful extensions: 268 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -