BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0530 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41510-7|AAK39381.2| 76|Caenorhabditis elegans Hypothetical pr... 34 0.085 Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical pr... 27 9.8 >U41510-7|AAK39381.2| 76|Caenorhabditis elegans Hypothetical protein ZC449.4 protein. Length = 76 Score = 34.3 bits (75), Expect = 0.085 Identities = 11/37 (29%), Positives = 28/37 (75%) Frame = +3 Query: 333 KSSNSSDGIRNKIMPIIMMIGAVLFLGLILYFIYRYM 443 K+ N + +RN+++ +++++ +L LG+++YF++R M Sbjct: 18 KNGNEASSLRNELLALMVLL-CLLILGVVIYFVFRSM 53 >Z19157-6|CAA79569.2| 1556|Caenorhabditis elegans Hypothetical protein ZC84.1 protein. Length = 1556 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 57 LAQSDVNICSRDPLLANDSPLLTNMCQGFNYETEKTVCRGSNPAANPNSP 206 L Q ++ C DP ++P + ++ ++ C GSNPA P P Sbjct: 1017 LVQGEIAQC--DPFNPPNAPCPSEFTCQWSLSNQRYQCCGSNPAPTPQRP 1064 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,749,941 Number of Sequences: 27780 Number of extensions: 244748 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -