BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0530 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23980.1 68414.m03028 zinc finger (C3HC4-type RING finger) fa... 31 0.97 >At1g23980.1 68414.m03028 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 369 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +3 Query: 336 SSNSSDGIRNKIMPIIM----MIGAVLFLGLILYFIYRYMTK 449 SS+SS G N+I PII+ ++ + F+ IL+ + RY K Sbjct: 38 SSSSSSGGNNRISPIILFIIVLLSVIFFICSILHLLVRYYLK 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,857,710 Number of Sequences: 28952 Number of extensions: 223138 Number of successful extensions: 429 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -