BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0527 (709 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42830-2|AAC48274.1| 243|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z81069-3|CAB02989.1| 352|Caenorhabditis elegans Hypothetical pr... 28 5.7 >U42830-2|AAC48274.1| 243|Caenorhabditis elegans Hypothetical protein C53B7.3 protein. Length = 243 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 110 YLSRTPAPYNKCINIDNKHPQKSKETCSSQECLSDVG 220 Y S TP+ N + + + S +TCS+ +C+S +G Sbjct: 18 YYSSTPSYSNSYRSCSSSYECSSGQTCSNGQCMSSLG 54 >Z81069-3|CAB02989.1| 352|Caenorhabditis elegans Hypothetical protein F25H9.3 protein. Length = 352 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 231 WRYSQYLYCTTESVKSVLKSVLWPISFPIEYCFVHFY 341 + YS Y CTT++ + +PIS P C+ Y Sbjct: 182 FHYSTYCKCTTKNCNDPEAPIPYPISSPTVSCYTSGY 218 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,805,675 Number of Sequences: 27780 Number of extensions: 289454 Number of successful extensions: 699 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -