BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0515 (797 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-628|AAF45943.3| 939|Drosophila melanogaster CG3626-PA ... 30 4.2 AY128477-1|AAM75070.1| 939|Drosophila melanogaster RE39339p pro... 29 5.6 AY069347-1|AAL39492.1| 396|Drosophila melanogaster LD05576p pro... 29 5.6 AE014134-3030|AAF53752.1| 396|Drosophila melanogaster CG10495-P... 29 5.6 AY094716-1|AAM11069.1| 1688|Drosophila melanogaster GH16393p pro... 29 9.7 AE014297-2048|AAF55199.3| 1537|Drosophila melanogaster CG14869-P... 29 9.7 AE014297-2047|AAS65157.1| 1688|Drosophila melanogaster CG14869-P... 29 9.7 >AE014298-628|AAF45943.3| 939|Drosophila melanogaster CG3626-PA protein. Length = 939 Score = 29.9 bits (64), Expect = 4.2 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 533 SFRIDNTYGKLNNKINIYLSDCKW-LPEPIDIYNVNAAS 420 SFR D T +L N + ++ DCKW L E +I N A+ Sbjct: 372 SFR-DATLDRLTNSLQVFSPDCKWILGEAPEIQNYYVAA 409 >AY128477-1|AAM75070.1| 939|Drosophila melanogaster RE39339p protein. Length = 939 Score = 29.5 bits (63), Expect = 5.6 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 533 SFRIDNTYGKLNNKINIYLSDCKW-LPEPIDIYNVNAAS 420 SFR D T +L N + ++ DCKW L E +I N A+ Sbjct: 372 SFR-DATLDRLTNSLQVFSPDCKWILGEAPEIKNYYVAA 409 >AY069347-1|AAL39492.1| 396|Drosophila melanogaster LD05576p protein. Length = 396 Score = 29.5 bits (63), Expect = 5.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 700 FLQEHYNMQKNRVDASVISRDDCRY 626 FL+EHYN++ + VD DC Y Sbjct: 316 FLKEHYNLEYSEVDPPSADYTDCTY 340 >AE014134-3030|AAF53752.1| 396|Drosophila melanogaster CG10495-PA protein. Length = 396 Score = 29.5 bits (63), Expect = 5.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 700 FLQEHYNMQKNRVDASVISRDDCRY 626 FL+EHYN++ + VD DC Y Sbjct: 316 FLKEHYNLEYSEVDPPSADYTDCTY 340 >AY094716-1|AAM11069.1| 1688|Drosophila melanogaster GH16393p protein. Length = 1688 Score = 28.7 bits (61), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 259 CPTVQTETHYCFTAETGRVVIPTRA 333 C V+ +CF + GR+ PTRA Sbjct: 1419 CEGVEKRRDFCFNSHKGRIACPTRA 1443 >AE014297-2048|AAF55199.3| 1537|Drosophila melanogaster CG14869-PA, isoform A protein. Length = 1537 Score = 28.7 bits (61), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 259 CPTVQTETHYCFTAETGRVVIPTRA 333 C V+ +CF + GR+ PTRA Sbjct: 1268 CEGVEKRRDFCFNSHKGRIACPTRA 1292 >AE014297-2047|AAS65157.1| 1688|Drosophila melanogaster CG14869-PB, isoform B protein. Length = 1688 Score = 28.7 bits (61), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 259 CPTVQTETHYCFTAETGRVVIPTRA 333 C V+ +CF + GR+ PTRA Sbjct: 1419 CEGVEKRRDFCFNSHKGRIACPTRA 1443 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,351,817 Number of Sequences: 53049 Number of extensions: 578233 Number of successful extensions: 1094 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3716337612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -