BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0513 (819 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0081 - 6608901-6609680,6610380-6610808,6610893-6610994,661... 30 1.9 01_05_0747 - 24857965-24858393,24858502-24860063,24860176-24860245 29 5.9 >02_02_0081 - 6608901-6609680,6610380-6610808,6610893-6610994, 6611114-6611429,6611624-6611806,6611909-6612030, 6612181-6612251,6612732-6612921 Length = 730 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -1 Query: 417 YTTFYVASHGNVI--KSILCPSPGFTLPPHQFSAKSVQ 310 Y T +V G I K+ P+P TLPP Q+S S++ Sbjct: 146 YCTVHVIHKGKAIQVKAAKAPAPFTTLPPKQYSQSSIE 183 >01_05_0747 - 24857965-24858393,24858502-24860063,24860176-24860245 Length = 686 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = -1 Query: 534 SLLAFPPKSPLQHSTIINHTIYYV*LS----VAFCYSISVAFCY 415 +L + PP S L S ++NH ++++ L+ V+F Y + V F + Sbjct: 327 TLASAPPTSFLHVSPVVNHVLWWISLALMGFVSFIYLLKVVFYF 370 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,068,597 Number of Sequences: 37544 Number of extensions: 392567 Number of successful extensions: 838 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -