BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0513 (819 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067609-5|AAC17534.1| 644|Caenorhabditis elegans Hypothetical ... 28 7.0 Z66523-9|CAE17856.1| 271|Caenorhabditis elegans Hypothetical pr... 28 9.2 AL031630-5|CAA20985.1| 915|Caenorhabditis elegans Hypothetical ... 28 9.2 >AF067609-5|AAC17534.1| 644|Caenorhabditis elegans Hypothetical protein C23H5.7 protein. Length = 644 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 478 YNILRLAVSCVLLFHISCVL--LYHVLCRVPRERYKKYPMSFSWFYATSSPIF 326 + I+ LAVSC++LFH + L L+ + + E ++ S +Y P+F Sbjct: 173 FKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFS---YYKVFEPVF 222 >Z66523-9|CAE17856.1| 271|Caenorhabditis elegans Hypothetical protein M05D6.9 protein. Length = 271 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 451 CVLLFHISCVLLYHVLCRVPRERYKKY-PMSFS 356 C+L F I + + V R+PR RY+K P FS Sbjct: 4 CLLTFFILILFSFLVESRIPRARYRKRGPTGFS 36 >AL031630-5|CAA20985.1| 915|Caenorhabditis elegans Hypothetical protein Y38H6C.5 protein. Length = 915 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = -1 Query: 684 RNPRSYVQQLCFIFPHLCTFTDIKQLINHRYYTFKPEE 571 R P S+V+++ FI L ++I +++ HR F P++ Sbjct: 815 RGPTSFVEEMEFIDVKLAIQSNITRVLAHRQKKFPPQK 852 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,526,044 Number of Sequences: 27780 Number of extensions: 395858 Number of successful extensions: 952 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2019417216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -