BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0512 (753 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharom... 26 5.0 SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit... 26 6.6 >SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 603 YNPIAKVRLAADNSI-LFTQKKKTCYLSTKHLIHGTYEG 490 YN +R A +S + QKK YLSTK+ I Y+G Sbjct: 193 YNTDDSIRGFAHSSFQMALQKKMPLYLSTKNTILKKYDG 231 >SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit Rrn7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 537 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 599 IQ*PRSDSPQTTLFYSLRKKKLVTSQLNT 513 I+ + D P FY RK+K+V + L+T Sbjct: 39 IEIAQDDEPGAGTFYQTRKRKVVRNHLDT 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,738,409 Number of Sequences: 5004 Number of extensions: 50709 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -