BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0512 (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.8 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 5.4 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 9.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.8 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -2 Query: 266 KSNTHRKDLRYMLYCCLCRERQHSLLPFSV*QRSQLTKYYYYDCRFE 126 ++ +R+++ +Y CL R S+ V R+ + +YY D E Sbjct: 66 RAEDYRQEVHAQVYSCLARSPAGSVHSRDVNVRAVVAQYYDTDVNKE 112 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -2 Query: 662 FFVSTSNTNLQFKSIYSLLPTIQ*PRSDSPQTTLFYSLRKKKLVTSQLN 516 F V ++ F YSL+PT + P TT ++ +K + +N Sbjct: 361 FDVKPEFGSIYFLGNYSLVPTTTASPTTEPSTTTSTTISQKHIKVFVVN 409 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 91 YSRHLKKNSNQSQLCA 44 Y ++ K+NS +S +CA Sbjct: 179 YPQNSKRNSEESAICA 194 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,829 Number of Sequences: 438 Number of extensions: 3668 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -