BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0511 (777 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trn... 28 8.6 AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trn... 28 8.6 AC024200-3|AAF36007.1| 305|Caenorhabditis elegans Hypothetical ... 28 8.6 >AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform a protein. Length = 909 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 638 KTSNAKL*IALCKSCLIQFNLNTFSSKSSLFAWYMFRKYGDT*SRN 775 +T+N+ + + +CL L SSK++ F RK+G T S+N Sbjct: 76 RTANSCVAVCSLFTCLHSLVLLLHSSKTTAFLGVFVRKFGTTRSKN 121 >AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform b protein. Length = 908 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 638 KTSNAKL*IALCKSCLIQFNLNTFSSKSSLFAWYMFRKYGDT*SRN 775 +T+N+ + + +CL L SSK++ F RK+G T S+N Sbjct: 76 RTANSCVAVCSLFTCLHSLVLLLHSSKTTAFLGVFVRKFGTTRSKN 121 >AC024200-3|AAF36007.1| 305|Caenorhabditis elegans Hypothetical protein Y71F9AL.12 protein. Length = 305 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 454 ATCYFKRLYYYSARY 498 A CYF YYYSA+Y Sbjct: 45 ADCYFIETYYYSAKY 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,750,107 Number of Sequences: 27780 Number of extensions: 278025 Number of successful extensions: 630 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1872168044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -