BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0511 (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.60 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 25.4 bits (53), Expect = 0.60 Identities = 11/42 (26%), Positives = 24/42 (57%) Frame = +2 Query: 449 SALPAILSGYIIIARAIYSYKIYNFENVFRVTKDAFYRTLQE 574 +A+ ++SG + A ++ S ++ N +FR+ +F+ T E Sbjct: 206 TAVRKVISGVVGAASSVTSIQVANLLRLFRIPLVSFFSTSPE 247 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 115 YIYYTNIFTWQDSNPG 162 Y+ Y F WQDS G Sbjct: 491 YVTYQEEFKWQDSPLG 506 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,568 Number of Sequences: 438 Number of extensions: 3642 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -