BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0509 (805 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19030.1 68417.m02804 major intrinsic family protein / MIP fa... 29 4.8 At3g10880.1 68416.m01310 hypothetical protein 28 6.3 >At4g19030.1 68417.m02804 major intrinsic family protein / MIP family protein contains Pfam profile: MIP PF00230; identical to cDNA NLM1 protein GI:2677613 Length = 296 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +3 Query: 6 NNPSFIKKKEYLLIV**LPILQFLWIRFLCDYSMLFIRCGS 128 +NP +KK++ LL V +P LQ L FL Y ++F C S Sbjct: 35 HNPRPLKKQDSLLSVS-VPFLQKLIAEFLGTYFLVFTGCAS 74 >At3g10880.1 68416.m01310 hypothetical protein Length = 278 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 307 TQSFLYVQPSLGQRYQFL*EKLPRHLDRIQIHCSLVS 417 T+ FLY+ SLG+ Y L ++L L +++ CSLV+ Sbjct: 10 TEKFLYLYQSLGETYNDLNQELLNGL--LKLPCSLVT 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,328,291 Number of Sequences: 28952 Number of extensions: 285124 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -