BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0505 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 29 4.9 SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) 28 6.5 >SB_57248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = -3 Query: 283 SCVRCLAILGHAVSFTPNLNCKQSDCTKQKIKLQNTGRKYAGAKIARKSDS*RVVKKRAN 104 +CVRC+ +L V F+ NL+ S + + + T +K ++ + S++ +V ++ Sbjct: 26 NCVRCVLLLAKGVPFSANLSQGFSTIAQSETFFRETFKKVVTLELLKPSETALIVFEKTE 85 Query: 103 WIPIVF---FFKYC 71 + + FF C Sbjct: 86 ESAVDYVTPFFAVC 99 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 Query: 362 ACTPSPRTPVWWCRGTGCCYLRPSWWQLCTLSCNFGTC 249 AC P+ R + C G GC P C +C G C Sbjct: 122 ACPPNARKCLQTCNGGGCHMTCPRGVGYCHQTCAHGRC 159 >SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1266 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -3 Query: 415 QRFRRHLLIISIGGDTWRRVPPRPVPLCGGAVVQGVVICVPRGGSCV 275 +R + ++S G R +PP P CG +QGV + GG+ V Sbjct: 995 ERIITYTKLLSEPGYHRRTLPPEDWPYCGALSIQGVSLEYLEGGTRV 1041 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,392,224 Number of Sequences: 59808 Number of extensions: 504236 Number of successful extensions: 1563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1558 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -