BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0504 (590 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical ... 30 1.4 Z82084-6|CAJ85781.1| 156|Caenorhabditis elegans Hypothetical pr... 27 7.5 U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical pr... 27 10.0 >AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical protein F39C12.1 protein. Length = 5105 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 9 QQERTKTIKNEIDHRCSSRPCGYRHRCPPY-RGLP*DRSV*IRRQPRWSLQLQFRDFQRH 185 Q ER K +KN++ +R SSR G H+ P + R LP D R+ R + Q +F+ + Sbjct: 2525 QLER-KFLKNKVHNRRSSRAPGIHHQRPLHPRWLPTDHET-DRKDSRAASQFRFQHMRSK 2582 Query: 186 R 188 R Sbjct: 2583 R 2583 >Z82084-6|CAJ85781.1| 156|Caenorhabditis elegans Hypothetical protein ZK1053.7 protein. Length = 156 Score = 27.5 bits (58), Expect = 7.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYF 315 ++ +YSY N DG P + TY+ Sbjct: 112 IKDTYSYDNVDGTPISCTYY 131 >U28971-5|AAA68379.1| 982|Caenorhabditis elegans Hypothetical protein B0244.6 protein. Length = 982 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 390 FRSLARGGGDLRNRFTLSMVSSLISEVRNGFGFAVSVRVTVASS 259 F SL R L+ TLS +S + VRN G+++ +A++ Sbjct: 449 FISLVRSSRKLKRSNTLSSSASSVKRVRNRLGWSIIAVCLIAAA 492 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,456,385 Number of Sequences: 27780 Number of extensions: 241945 Number of successful extensions: 720 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -