BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0497 (801 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27D7.08c |||DUF890 family protein|Schizosaccharomyces pombe|... 26 5.4 SPBC216.06c |swi1||replication fork protection complex subunit S... 26 7.2 >SPAC27D7.08c |||DUF890 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 385 Score = 26.2 bits (55), Expect = 5.4 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 84 IYTLVGCRQYSLDLV 128 IY L+GCR YS D V Sbjct: 89 IYPLLGCRMYSYDFV 103 >SPBC216.06c |swi1||replication fork protection complex subunit Swi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 971 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 622 NIPTKLKDSNSFGDMRLTDTTTIHEKLLIRTSLANKYI 509 N+ K S F D LT++ T LL++ S N+Y+ Sbjct: 224 NLIRGCKPSALFSDASLTNSQTELNSLLLKESTQNRYL 261 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,933,754 Number of Sequences: 5004 Number of extensions: 57185 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -