BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0497 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.6 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 84 IYTLVGCRQYSLDLVLQRSE 143 ++ GCRQ +LDL Q E Sbjct: 1002 VWLFFGCRQRNLDLYRQEKE 1021 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 22 HSMSLS*SIHSVRC*TEFRF-RSTPLSDVGS 111 HS+ S IH RC T R R +S V + Sbjct: 196 HSLEFSDQIHGYRCRTMHRLTRQVVVSSVAN 226 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 22 HSMSLS*SIHSVRC*TEFRF-RSTPLSDVGS 111 HS+ S IH RC T R R +S V + Sbjct: 196 HSLEFSDQIHGYRCRTMHRLTRQVVVSSVAN 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,521 Number of Sequences: 438 Number of extensions: 4122 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -