BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0496 (754 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I5X9 Cluster: DNA-directed RNA polymerase; n=8; Plasm... 34 3.3 UniRef50_Q5AHZ0 Cluster: Potential mitochondrial protein Fmp47; ... 34 4.3 UniRef50_Q83DA1 Cluster: Conserved domain protein; n=4; Coxiella... 33 7.6 UniRef50_A5KA11 Cluster: Putative uncharacterized protein; n=1; ... 33 7.6 UniRef50_A0DJ74 Cluster: Chromosome undetermined scaffold_52, wh... 33 7.6 UniRef50_A4Q3T7 Cluster: Terpene synthase-like; Terpenoid syntha... 33 10.0 >UniRef50_Q8I5X9 Cluster: DNA-directed RNA polymerase; n=8; Plasmodium|Rep: DNA-directed RNA polymerase - Plasmodium falciparum (isolate 3D7) Length = 1450 Score = 34.3 bits (75), Expect = 3.3 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +3 Query: 42 NNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNSY-TLKRQLLETFVVLLLCSYETRVS 218 NNK +D K YY + + ++ S F D+ Y TLK+Q+ +T + +Y +++ Sbjct: 575 NNKNEIDDKDYYGNKRLELAGQLISLLFEDLYKRFYFTLKKQIDQTLSKYMQSNYNSKLR 634 Query: 219 NT 224 +T Sbjct: 635 ST 636 >UniRef50_Q5AHZ0 Cluster: Potential mitochondrial protein Fmp47; n=1; Candida albicans|Rep: Potential mitochondrial protein Fmp47 - Candida albicans (Yeast) Length = 1179 Score = 33.9 bits (74), Expect = 4.3 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +3 Query: 78 STNKYLIFTKISSYNF*DISHNSYTLKRQLLETFVVL--LLCS 200 S + Y+I +I +Y F +S SYTLK Q+++T +L LLC+ Sbjct: 963 SKDIYMISLRIFNYGFTLVSQESYTLKTQIIKTLRLLLPLLCT 1005 >UniRef50_Q83DA1 Cluster: Conserved domain protein; n=4; Coxiella burnetii|Rep: Conserved domain protein - Coxiella burnetii Length = 494 Score = 33.1 bits (72), Expect = 7.6 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +3 Query: 24 HRQSLINNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNSYTLKRQLLETFVVLLLCSY 203 H +SL ++ V CK + N ++IF I +NF I+ + L L+ ++++ L ++ Sbjct: 259 HYKSLTFSEIMVQCKHIFHINYWIIFLAIGMWNFNSINPLQHFLMFFLIGIYILVFLVTF 318 >UniRef50_A5KA11 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 2591 Score = 33.1 bits (72), Expect = 7.6 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 494 SNTRRAHCGLGE-CVITINSYK-NSLHLCNIFKCDTRKYNGLHKAY 625 +N + G GE C + NSY N+L L N + + + YN LHK Y Sbjct: 2291 NNDDNSDSGEGEGCALLANSYNSNALFLDNDYSVEKKIYNDLHKQY 2336 >UniRef50_A0DJ74 Cluster: Chromosome undetermined scaffold_52, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_52, whole genome shotgun sequence - Paramecium tetraurelia Length = 1841 Score = 33.1 bits (72), Expect = 7.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 51 YNVDCKQYYSTNKYLIFTKISSY 119 YN +CK++ S KY FT ISSY Sbjct: 999 YNFECKEFSSQLKYTFFTSISSY 1021 >UniRef50_A4Q3T7 Cluster: Terpene synthase-like; Terpenoid synthase; n=4; Medicago truncatula|Rep: Terpene synthase-like; Terpenoid synthase - Medicago truncatula (Barrel medic) Length = 557 Score = 32.7 bits (71), Expect = 10.0 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +2 Query: 467 QWKQNWPIVSNTRRAHCGLGECVITINSYKNSLHLCNIFKCDTRKYNGLHKAYI 628 +W NWP + + C L + ++T + H+C++ C ++Y +A I Sbjct: 434 KWVSNWPKIVDAISTICRLMDEIVTSEFERKRGHVCSLLDCYMKQYGMSREAAI 487 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,126,002 Number of Sequences: 1657284 Number of extensions: 12559770 Number of successful extensions: 29201 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29153 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62146450145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -