BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0495 (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55786| Best HMM Match : DUF926 (HMM E-Value=0) 136 1e-32 SB_29296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) 33 0.25 SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) 33 0.25 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) 31 0.78 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_55739| Best HMM Match : Protamine_P2 (HMM E-Value=1.9) 29 4.2 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) 29 4.2 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 29 5.5 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 29 5.5 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 28 7.3 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) 28 7.3 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 28 9.6 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) 28 9.6 SB_10317| Best HMM Match : rve (HMM E-Value=8e-07) 28 9.6 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 28 9.6 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_12826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_55786| Best HMM Match : DUF926 (HMM E-Value=0) Length = 137 Score = 136 bits (330), Expect = 1e-32 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +3 Query: 411 FVADGKRIPRRGEIGLTSDEIASYEAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALA 590 +V GKRIPRRGEIGLTSDEIA++E GYVMSGSRHRRMEAVR+RKENQIYSADEKRALA Sbjct: 48 YVKAGKRIPRRGEIGLTSDEIATFEDQGYVMSGSRHRRMEAVRLRKENQIYSADEKRALA 107 Query: 591 AFSKDERNKRENAILSQFRDVLKARQK 671 F+ +ER+KREN ILS FR+++ + K Sbjct: 108 MFNYEERSKRENKILSDFRELIHQKTK 134 >SB_29296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.5 bits (73), Expect = 0.19 Identities = 25/83 (30%), Positives = 40/83 (48%) Frame = +3 Query: 426 KRIPRRGEIGLTSDEIASYEAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALAAFSKD 605 K + RGE ++ +E S A Y M +RH+R R R++ + D+K+ + Sbjct: 25 KALRARGE-AISEEESRSVFARNYCMIWARHKRCFKPRSRQKQSVRDFDKKKEDKIRQEQ 83 Query: 606 ERNKRENAILSQFRDVLKARQKR 674 E ENA++ F K R+KR Sbjct: 84 EVLTDENAVIDGFP---KYRRKR 103 >SB_32780| Best HMM Match : SAICAR_synt (HMM E-Value=0) Length = 278 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +1 Query: 193 VPAVT---LVQVKKRYGWKKEKSMKFNRHNQNYV 285 +P VT L QVKK Y W +S K N+HN +V Sbjct: 232 LPEVTPEALEQVKKNYAWVAGESQKLNKHNPGHV 265 >SB_21014| Best HMM Match : SAICAR_synt (HMM E-Value=2.2e-28) Length = 265 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +1 Query: 193 VPAVT---LVQVKKRYGWKKEKSMKFNRHNQNYV 285 +P VT L QVKK Y W +S K N+HN +V Sbjct: 142 LPEVTPEALEQVKKNYAWVAGESQKLNKHNPGHV 175 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 87 SCSFLVPNSCSPGXPLV 37 SC++ + NSCSPG PLV Sbjct: 2 SCTYFISNSCSPGDPLV 18 >SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) Length = 506 Score = 31.5 bits (68), Expect = 0.78 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +3 Query: 483 EAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALAAFSKDERNKRENAILSQFRDVLKA 662 + VG + S R E R+R++ AD + A++K+ER +E I Q R +L+ Sbjct: 424 DTVGGIASHITSLREEIRRLRQQLAKSEADYCEKMEAYAKEERQTKEENIRLQ-RKLLRE 482 Query: 663 RQKRE 677 ++RE Sbjct: 483 MERRE 487 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 81 SFLVPNSCSPGXPLV 37 SFL+ NSCSPG PLV Sbjct: 15 SFLISNSCSPGDPLV 29 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 +S SF + NSCSPG PLV Sbjct: 36 VSISFFLSNSCSPGDPLV 53 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 84 CSFLVPNSCSPGXPLV 37 CS+ + NSCSPG PLV Sbjct: 28 CSYRISNSCSPGDPLV 43 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 219 EEEIWVEKGKEHEVQQAQSKLCKDNEELSSEI 314 EEE+ VE+ K ++Q+ ++CK+ EE+ E+ Sbjct: 2872 EEELNVERVKSAKLQRELVRVCKEKEEMDKEL 2903 >SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 88 FLLFPRAEFLQPGGXTS 38 FLL+ R EFLQPGG TS Sbjct: 12 FLLYLRIEFLQPGGSTS 28 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 81 SFLVPNSCSPGXPLV 37 SFL+ NSCSPG PLV Sbjct: 5 SFLLSNSCSPGDPLV 19 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 ISC NSCSPG PLV Sbjct: 14 ISCGRFASNSCSPGDPLV 31 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 IS + ++ NSCSPG PLV Sbjct: 9 ISANIIISNSCSPGDPLV 26 >SB_55739| Best HMM Match : Protamine_P2 (HMM E-Value=1.9) Length = 678 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 453 GLTSDEIASYEAVGYVMSGSRHRRMEAVRIRKEN 554 G++SDE +SYE + Y SG R + I +EN Sbjct: 314 GVSSDESSSYEFIIYQSSGDIRHRTRSSDIGREN 347 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 314 HWSRGSCDRQWS 349 HWSRG DRQWS Sbjct: 159 HWSRGDDDRQWS 170 >SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1924 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 559 STRLMRSAPSPHLARTKGTNGKTLSLASLEMSSKPDKNEKLSTNKYLVPQQRH 717 +T R P + T+GT T L + +++ D N + N+YL QQRH Sbjct: 1827 ATNYCRHIPQQYPESTRGTT--TQCLQPITRATELDTNPRPLENEYLPHQQRH 1877 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 IS + ++ NSCSPG PLV Sbjct: 9 ISANIVISNSCSPGDPLV 26 >SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) Length = 1737 Score = 29.1 bits (62), Expect = 4.2 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 528 EAVRIRKENQIYSADEKRALAAFSKDERN-KRENAILSQFRDVLKARQKRET*YE*ISCA 704 EA R N+ S + LA S+D+ K E + S + + KR T + IS + Sbjct: 420 EAPRKAITNRKLSHNHLNKLAEKSQDKNEEKSEKPVNSLKKPTARKSTKRVTFQDDISTS 479 Query: 705 PAETPLNQGITRLK 746 PAE ++ I RLK Sbjct: 480 PAEPAVSPPIKRLK 493 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 78 FLVPNSCSPGXPLV 37 FL+ NSCSPG PLV Sbjct: 20 FLISNSCSPGDPLV 33 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 78 FLVPNSCSPGXPLV 37 FL+ NSCSPG PLV Sbjct: 15 FLISNSCSPGDPLV 28 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 41 SGSPGLQEFGTRKEQEIKRFQRQH 112 SGSPGLQEF KE++ +++ R H Sbjct: 1440 SGSPGLQEF-DEKEKDTRQWTRLH 1462 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -3 Query: 84 CSFLVPNSCSPGXPLV 37 CSF V NSCSPG PLV Sbjct: 11 CSF-VSNSCSPGDPLV 25 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 38 TSGSPGLQEFGTRK 79 TSGSPGLQEF RK Sbjct: 14 TSGSPGLQEFDMRK 27 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 38 TSGSPGLQEFGTRKE 82 TSGSPGLQEF T+ + Sbjct: 14 TSGSPGLQEFDTKNQ 28 >SB_13002| Best HMM Match : Ribonuc_2-5A (HMM E-Value=9.5) Length = 91 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 38 TSGSPGLQEFGTRKEQEI 91 TSGSPGLQEF R E+ + Sbjct: 14 TSGSPGLQEFDHRAERVV 31 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +2 Query: 38 TSGSPGLQEFGTRKEQEIK 94 TSGSPGLQEF +E++++ Sbjct: 14 TSGSPGLQEFDDDEEKKVQ 32 >SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1320 Score = 28.3 bits (60), Expect = 7.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +3 Query: 222 EEIWVEKGKEHEVQQAQSKLCKDNEELSS 308 ++IW + +H ++ QS LC D++E S Sbjct: 1264 KQIWEQTSPQHTLRHKQSGLCLDSKEAKS 1292 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 IS + V NSCSPG PLV Sbjct: 9 ISANISVSNSCSPGDPLV 26 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +1 Query: 550 RTRSTRLMRSAPSPHLARTKGTNGKTLSLASLEMSSKPDKNEKLSTNKYLV 702 R+R R RS SP RT+ + + S ++S PDK++ +KY++ Sbjct: 346 RSRPPRGRRSQ-SPRRRRTRSRSRRRCRSKSSSIASSPDKSKDEDMSKYML 395 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 IS + + NSCSPG PLV Sbjct: 9 ISANIFLSNSCSPGDPLV 26 >SB_20220| Best HMM Match : E-MAP-115 (HMM E-Value=2.1) Length = 405 Score = 27.9 bits (59), Expect = 9.6 Identities = 18/71 (25%), Positives = 32/71 (45%) Frame = +3 Query: 417 ADGKRIPRRGEIGLTSDEIASYEAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALAAF 596 ++GKR+PR L D ++ G + + HRR + + RK ++ ++ A Sbjct: 267 SEGKRLPRNAAPFLIDDPVSWEVDFGESSNEAAHRRRQERKQRKIQKLREKLKRSKNTAD 326 Query: 597 SKDERNKRENA 629 DER + A Sbjct: 327 LPDERLRSNGA 337 >SB_10317| Best HMM Match : rve (HMM E-Value=8e-07) Length = 195 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 614 VPFVLAKCGEGALLISRVDLVLFADTYCFHASMSAPTHDISN 489 +P VL +G + + +FA T+CF +S+PT+ SN Sbjct: 61 IPDVLVT--DGGPQLGSAEFAVFARTWCFDHILSSPTYAQSN 100 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 38 TSGSPGLQEFGTRKE 82 TSGSPGLQEF R E Sbjct: 14 TSGSPGLQEFDKRAE 28 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 78 FLVPNSCSPGXPLV 37 +L+ NSCSPG PLV Sbjct: 7 YLISNSCSPGDPLV 20 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 81 SFLVPNSCSPGXPLV 37 +F + NSCSPG PLV Sbjct: 44 NFFISNSCSPGDPLV 58 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 +S F+ NSCSPG PLV Sbjct: 7 LSLGFVPSNSCSPGDPLV 24 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 27.9 bits (59), Expect = 9.6 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Frame = -3 Query: 522 VDVCSHS*HIQQLHRRQFHQM*VQFLLCVEF------SFRLPQKQPWQHLLQVVEHHQAP 361 V V +HS H Q+L +++ H + + L C++ R+ + L + E P Sbjct: 354 VFVLNHSYHFQELPKQEDHIVQLNVLKCLQVLVLRGDYLRVAMEAEPDFLAYLQEIFFIP 413 Query: 360 *H*ELHCRSHEPLDQ*SPKIILHCL 286 EL H L + + +I+LHC+ Sbjct: 414 NLWELLQAEHSDLSEIATRILLHCI 438 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 90 ISCSFLVPNSCSPGXPLV 37 I C V NSCSPG PLV Sbjct: 28 IICICTVSNSCSPGDPLV 45 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 81 SFLVPNSCSPGXPLV 37 +F++ NSCSPG PLV Sbjct: 102 TFILSNSCSPGDPLV 116 >SB_12826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 38 TSGSPGLQEFGTRKEQE 88 TSGSPGLQEF K+++ Sbjct: 14 TSGSPGLQEFDPTKDEK 30 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 73 RAEFLQPGGXTSXERPPXR 17 R EFLQPG ERPP R Sbjct: 31 RIEFLQPGDPLVLERPPPR 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,450,360 Number of Sequences: 59808 Number of extensions: 328156 Number of successful extensions: 2561 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 2448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2560 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -