BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0494 (473 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15501| Best HMM Match : Not1 (HMM E-Value=4.6e-37) 30 1.1 SB_29526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_32263| Best HMM Match : Ldh_1_C (HMM E-Value=8.80015e-42) 28 4.5 SB_23538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) 27 6.0 SB_52207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_31428| Best HMM Match : Tetraspannin (HMM E-Value=0) 27 7.9 >SB_15501| Best HMM Match : Not1 (HMM E-Value=4.6e-37) Length = 509 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -1 Query: 236 VSFLVTEADTFVPSIAFVTAVAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAF 72 VS V EA F S + A+ F + ++ +I V D P + + F CLRC F Sbjct: 275 VSDPVLEAINFQVSDPLLEAINFQVSDPVLEAINFQVSD-PVLEAINFQCLRCRF 328 >SB_29526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -1 Query: 236 VSFLVTEADTFVPSIAFVTAVAFIATSEIMSSIRSYVIDAPFVLFLLFDCLRCAF 72 VS V EA F S + A+ F + ++ +I V D P + + F CLRC F Sbjct: 883 VSDPVLEAINFQVSDPLLEAINFQVSDPVLEAINFQVSD-PVLEAINFQCLRCRF 936 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = -3 Query: 189 FRDRRSLHRYLRNYVLHKILCHRCPFCLVSSLRLPSVCLSPPWQRQPRPTMPPK*PCT 16 + D R R+ + HK HRCP L S++ + C P + R T P P T Sbjct: 1146 YADPRDCSRFYQCDAFHKTFLHRCPAGLKWSVK-KTACDWPRYVDCDRTTSTPPTPTT 1202 >SB_32263| Best HMM Match : Ldh_1_C (HMM E-Value=8.80015e-42) Length = 411 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 396 APSLPPQQF*CARGVHDDRGGSRLRWQL 313 APS+P + F C + +RGGS++ +L Sbjct: 222 APSIPKENFSCLTRLDQNRGGSQIAGRL 249 >SB_23538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 131 YVIDAPFVLFLLFDCLRCAFLLL 63 YVI P L L DCL C F+++ Sbjct: 41 YVIGVPMCLVLTDDCLLCRFIVM 63 >SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) Length = 910 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 177 RSLHRYLRNYVLHKILCHRCPFCLVSSLR 91 R+L+R+L HK CPFCL +R Sbjct: 220 RNLNRFLSRQTKHKGRMFYCPFCLHGFVR 248 >SB_52207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 177 RSLHRYLRNYVLHKILCHRCPFCLVSSLR 91 ++L+R+L HK CPFCL LR Sbjct: 98 QNLNRFLSRQTKHKGRMFYCPFCLHGFLR 126 >SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 60 AKEEKGTPKAVEEKKQDKRGIYDIGS 137 +++EKGTPK +E+K+ K G Y+ S Sbjct: 34 SRDEKGTPKTTKEQKK-KEGQYNCPS 58 >SB_31428| Best HMM Match : Tetraspannin (HMM E-Value=0) Length = 280 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 424 TCFSTVYGTGTFFTTSTVLMC 362 TCF TVYGT F ++ C Sbjct: 104 TCFLTVYGTSVFLCLILLIAC 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,958,836 Number of Sequences: 59808 Number of extensions: 184087 Number of successful extensions: 608 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -